bio-sequence-properties

SkillDev tools

Calculate physical and chemical properties of biological sequences using Biopython.

Instructions available. Your AI can read the instructions. Execution depends on the setup they require.

Add ahel to your AI once: Claude, ChatGPT, Cursor, Claude Code or Codex. Then ask it to use this.

Then ask your AI: use the bio-sequence-properties skill

About this skill

The largest open-source medical AI skills library for OpenClaw🦞.

What this skill tells your AI

The instructions your AI receives, as published by freedomintelligence/openclaw-medical-skills in skills/bio-sequence-properties/SKILL.md and read by ahel’s review.


name: bio-sequence-properties description: Calculate sequence properties like GC content, molecular weight, isoelectric point, and GC skew using Biopython. Use when analyzing sequence composition, computing physical properties, or comparing sequences. tool_type: python primary_tool: Bio.SeqUtils measurable_outcome: Execute skill workflow successfully with valid output within 15 minutes. allowed-tools:

  • read_file
  • run_shell_command

Sequence Properties

Calculate physical and chemical properties of biological sequences using Biopython.

Required Imports

from Bio.Seq import Seq
from Bio.SeqUtils import gc_fraction, molecular_weight, GC123, GC_skew, nt_search, seq1, seq3
from Bio.SeqUtils.ProtParam import ProteinAnalysis

DNA/RNA Properties

GC Content

from Bio.SeqUtils import gc_fraction

seq = Seq('ATGCGATCGATCGATCGATCG')
gc = gc_fraction(seq)  # Returns 0.476... (fraction)
gc_percent = gc * 100  # Convert to percentage

Handle ambiguous bases:

gc = gc_fraction(seq, ambiguous='ignore')  # Ignore N bases in calculation
gc = gc_fraction(seq, ambiguous='weighted')  # Weight by probability

GC at Codon Positions (GC123)

Analyze GC content at each codon position (useful for codon bias analysis):

from Bio.SeqUtils import GC123

seq = Seq('ATGCGATCGATCGATCGATCG')
gc_total, gc_pos1, gc_pos2, gc_pos3 = GC123(seq)
# gc_total: overall GC%
# gc_pos1: GC% at 1st codon position
# gc_pos2: GC% at 2nd codon position
# gc_pos3: GC% at 3rd codon position (wobble)

GC Skew

Calculate (G-C)/(G+C) in sliding windows to identify replication origins:

from Bio.SeqUtils import GC_skew

seq = Seq('ATGCGATCGATCGATCGATCG' * 10)
skew_values = GC_skew(seq, window=100)  # Returns list of skew values

Molecular Weight

from Bio.SeqUtils import molecular_weight

dna = Seq('ATGCGATCG')
mw = molecular_weight(dna)  # Single-stranded DNA weight

# Double-stranded DNA
mw_ds = molecular_weight(dna, double_stranded=True)

# Circular DNA
mw_circ = molecular_weight(dna, circular=True)

# RNA
rna = Seq('AUGCGAUCG')
mw_rna = molecular_weight(rna, seq_type='RNA')

# Protein
protein = Seq('MRCRS')
mw_prot = molecular_weight(protein, seq_type='protein')

Melting Temperature

from Bio.SeqUtils import MeltingTemp

seq = Seq('ATGCGATCGATCG')

# Basic Tm (Wallace rule - short oligos)
tm_wallace = MeltingTemp.Tm_Wallace(seq)

# GC method (more accurate for longer sequences)
tm_gc = MeltingTemp.Tm_GC(seq)

# Nearest neighbor (most accurate)
tm_nn = MeltingTemp.Tm_NN(seq)

# With salt correction
tm_corrected = MeltingTemp.Tm_NN(seq, Na=50, Mg=1.5)

Sequence Search with IUPAC Codes (nt_search)

Built-in search that handles IUPAC ambiguity codes:

from Bio.SeqUtils import nt_search

seq = 'ATGCGATCGATCGATNGATC'
# Search for pattern with ambiguous bases
result = nt_search(seq, 'GATNGATC')  # N matches any base
# Returns: ['GATNGATC', 8] - pattern and position(s)

Base Composition

def base_composition(seq):
    seq_str = str(seq).upper()
    total = len(seq_str)
    return {base: seq_str.count(base) / total * 100 for base in 'ATGC'}

Amino Acid Code Conversion

Convert between 1-letter and 3-letter amino acid codes:

from Bio.SeqUtils import seq1, seq3

# 3-letter to 1-letter
one_letter = seq1('MetAlaGlyTrp')  # Returns 'MAGW'

# 1-letter to 3-letter
three_letter = seq3('MAGW')  # Returns 'MetAlaGlyTrp'

# With custom separator
three_letter = seq3('MAGW', join='-')  # Returns 'Met-Ala-Gly-Trp'

Protein Properties

Using ProteinAnalysis

from Bio.SeqUtils.ProtParam import ProteinAnalysis

protein = ProteinAnalysis('MAEGEITTFTALTEKFNLPPGNYKKPKLLYCSNG')

Basic Properties

mw = protein.molecular_weight()           # Molecular weight in Daltons
pi = protein.isoelectric_point()          # Isoelectric point
aa_comp = protein.amino_acids_percent     # Amino acid composition (property)
aa_count = protein.count_amino_acids()    # Raw amino acid counts

Stability and Hydropathy

instability = protein.instability_index()  # < 40 = stable, > 40 = unstable
gravy = protein.gravy()                    # Negative = hydrophilic, Positive = hydrophobic
arom = protein.aromaticity()               # Fraction of Phe+Trp+Tyr

Charge at Specific pH

charge = protein.charge_at_pH(7.0)  # Net charge at pH 7.0
charge_acidic = protein.charge_at_pH(4.0)
charge_basic = protein.charge_at_pH(10.0)

Flexibility Profile

flexibility = protein.flexibility()  # List of flexibility values per residue
# Based on Vihinen, 1994 scale

Secondary Structure

helix, turn, sheet = protein.secondary_structure_fraction()

Extinction Coefficient

eps_reduced, eps_cystine = protein.molar_extinction_coefficient()
# eps_reduced: all Cys are reduced
# eps_cystine: all Cys form disulfide bonds

Protein Scale Profiles

Calculate profiles using any amino acid scale:

# Kyte-Doolittle hydropathy profile
kd_scale = {'A': 1.8, 'R': -4.5, 'N': -3.5, ...}
profile = protein.protein_scale(kd_scale, window=7)

Code Patterns

Analyze Multiple Sequences

from Bio import SeqIO
from Bio.SeqUtils import gc_fraction

def analyze_fasta(filename):
    results = []
    for record in SeqIO.parse(filename, 'fasta'):
        results.append({
            'id': record.id,
            'length': len(record.seq),
            'gc': gc_fraction(record.seq) * 100
        })
    return results

GC Content Distribution (Sliding Windows)

from Bio.SeqUtils import gc_fraction

def gc_distribution(seq, window_size=100, step=50):
    gc_values = []
    for i in range(0, len(seq) - window_size + 1, step):
        window = seq[i:i + window_size]
        gc_values.append((i, gc_fraction(window) * 100))
    return gc_values

GC Skew Plot Data

from Bio.SeqUtils import GC_skew

def gc_skew_analysis(seq, window=1000):
    skew = GC_skew(seq, window=window)
    positions = list(range(0, len(seq) - window + 1, window))
    cumulative = []
    total = 0
    for s in skew:
        total += s
        cumulative.append(total)
    return positions, skew, cumulative

Full Protein Analysis Report

from Bio.SeqUtils.ProtParam import ProteinAnalysis

def protein_report(sequence):
    protein = ProteinAnalysis(str(sequence).replace('*', ''))
    helix, turn, sheet = protein.secondary_structure_fraction()
    return {
        'length': len(sequence),
        'molecular_weight': protein.molecular_weight(),
        'isoelectric_point': protein.isoelectric_point(),
        'charge_at_pH7': protein.charge_at_pH(7.0),
        'instability_index': protein.instability_index(),
        'gravy': protein.gravy(),
        'aromaticity': protein.aromaticity(),
        'helix_fraction': helix,
        'turn_fraction': turn,
        'sheet_fraction': sheet,
    }

Dinucleotide Frequencies

from collections import Counter

def dinucleotide_freq(seq):
    seq_str = str(seq)
    dinucs = [seq_str[i:i+2] for i in range(len(seq_str) - 1)]
    counts = Counter(dinucs)
    total = sum(counts.values())
    return {di: count / total for di, count in counts.items()}

CpG Observed/Expected Ratio

def cpg_ratio(seq):
    seq_str = str(seq).upper()
    cpg = seq_str.count('CG')
    c = seq_str.count('C')
    g = seq_str.count('G')
    expected = (c * g) / len(seq_str) if len(seq_str) > 0 else 0
    return cpg / expected if expected > 0 else 0

Property Reference

DNA/RNA Properties

PropertyFunctionNotes
GC contentgc_fraction()Returns fraction (0-1)
GC by positionGC123()Total, pos1, pos2, pos3
GC skewGC_skew()(G-C)/(G+C) in windows
Molecular weightmolecular_weight()In Daltons
Melting tempMeltingTemp.Tm_*()Multiple methods
IUPAC searchnt_search()Handles ambiguity codes

Protein Properties

PropertyMethodTypical Range
MWmolecular_weight()Daltons
pIisoelectric_point()0-14
Chargecharge_at_pH(pH)Varies
Instabilityinstability_index()<40 stable
GRAVYgravy()-2 to +2
Aromaticityaromaticity()0-0.15
Flexibilityflexibility()Per-residue list

Amino Acid Codes

FunctionInputOutput
seq1()'MetAlaGly''MAG'
seq3()'MAG''MetAlaGly'

Common Errors

ErrorCauseSolution
KeyError in ProteinAnalysisNon-standard amino acidRemove X, *, etc.
Wrong MWWrong seq_typeSpecify 'RNA' or 'protein'
Invalid TmSequence too shortUse >10 bp for accurate Tm
Empty GC_skewSequence shorter than windowReduce window size

Decision Tree

Need sequence properties?
β”œβ”€β”€ DNA/RNA sequence?
β”‚   β”œβ”€β”€ GC content? β†’ gc_fraction()
β”‚   β”œβ”€β”€ GC at codon positions? β†’ GC123()
β”‚   β”œβ”€β”€ GC skew (replication origin)? β†’ GC_skew()
β”‚   β”œβ”€β”€ Molecular weight? β†’ molecular_weight()
β”‚   β”œβ”€β”€ Melting temperature? β†’ MeltingTemp.Tm_NN()
β”‚   └── Search with IUPAC codes? β†’ nt_search()
β”œβ”€β”€ Protein sequence?
β”‚   └── Create ProteinAnalysis object
β”‚       β”œβ”€β”€ Size β†’ molecular_weight()
β”‚       β”œβ”€β”€ Charge β†’ isoelectric_point(), charge_at_pH()
β”‚       β”œβ”€β”€ Stability β†’ instability_index()
β”‚       β”œβ”€β”€ Hydrophobicity β†’ gravy()
β”‚       β”œβ”€β”€ Flexibility β†’ flexibility()
β”‚       └── Structure β†’ secondary_structure_fraction()
└── Convert amino acid codes?
    └── seq1() / seq3()

Related Skills

  • seq-objects - Create Seq objects for property calculation
  • sequence-io/sequence-statistics - File-level statistics (N50, totals)
  • codon-usage - GC123 for codon position analysis
  • transcription-translation - Translate before protein analysis
  • alignment-files/bam-statistics - samtools stats for alignment-level GC and quality stats

Signals

GitHub stars
3k
Forks
412
Last commit
Jul 2026

ahel review

  • K1binfo
    installs-packages (in usage-guide.md)

Automated review, not a security audit. Ruleset v1+k2.

Advanced
Item type
skill
Key
bio-sequence-properties
Source
github.com/freedomintelligence/openclaw-medical-skills