Boltz-2 Protein-Ligand Binding Affinity Prediction
SkillAI & modelsPredict protein-ligand binding affinity using Boltz-2 model to assess molecular interactions and binding probability for drug discovery.
Available today. Use it from your connected AI after setup.
No other account needed.
Connect ahel once, and every AI you use reads what you have installed.
Then ask your AI: use the Boltz-2 Protein-Ligand Binding Affinity Prediction skill
What this skill tells your AI
The instructions your AI receives, as published by internscience/scp in skills/boltz2-binding-affinity/SKILL.md and read by ahel’s review.
Usage
1. MCP Server Definition
import asyncio
import json
from mcp.client.streamable_http import streamablehttp_client
from mcp import ClientSession
class DrugSDAClient:
"""DrugSDA-Model MCP Client"""
def __init__(self, server_url: str, api_key: str):
self.server_url = server_url
self.api_key = api_key
self.session = None
async def connect(self):
"""Establish connection and initialize session"""
print(f"server url: {self.server_url}")
try:
self.transport = streamablehttp_client(
url=self.server_url,
headers={"SCP-HUB-API-KEY": self.api_key}
)
self.read, self.write, self.get_session_id = await self.transport.__aenter__()
self.session_ctx = ClientSession(self.read, self.write)
self.session = await self.session_ctx.__aenter__()
await self.session.initialize()
session_id = self.get_session_id()
print(f"✓ connect success")
return True
except Exception as e:
print(f"✗ connect failure: {e}")
import traceback
traceback.print_exc()
return False
async def disconnect(self):
"""Disconnect from server"""
try:
if self.session:
await self.session_ctx.__aexit__(None, None, None)
if hasattr(self, 'transport'):
await self.transport.__aexit__(None, None, None)
print("✓ already disconnect")
except Exception as e:
print(f"✗ disconnect error: {e}")
def parse_result(self, result):
"""Parse MCP tool call result"""
try:
if hasattr(result, 'content') and result.content:
content = result.content[0]
if hasattr(content, 'text'):
return json.loads(content.text)
return str(result)
except Exception as e:
return {"error": f"parse error: {e}", "raw": str(result)}
2. Boltz-2 Binding Affinity Workflow
This workflow predicts protein-ligand binding affinity using the Boltz-2 deep learning model, providing affinity probabilities and 3D complex structures.
Workflow Steps:
- Prepare Input - Define protein sequence and SMILES list for ligands
- Run Boltz-2 Prediction - Calculate binding affinity probability for each ligand
- Analyze Results - Extract affinity scores and structure files
Implementation:
## Initialize client
client = DrugSDAClient(
"https://scp.intern-ai.org.cn/api/v1/mcp/3/DrugSDA-Model",
"<your-api-key>"
)
if not await client.connect():
print("connection failed")
exit()
## Input: Protein sequence and ligand SMILES
sequence = 'PIVQNLQGQMVHQCISPRTLNAWVKVVEEKAFSPEVIPMFSALSCGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNAATETLLVQNANPDCKTILKALGPGATLEEMMTACQG'
protein = [{'chain': 'A', 'sequence': sequence}]
smiles_list = ['N[C@@H](Cc1ccc(O)cc1)C(=O)O', "CC(C)C1=CC=CC=C1"]
## Execute Boltz-2 binding affinity prediction
result = await client.session.call_tool(
"boltz_binding_affinity",
arguments={
"protein": protein,
"smiles_list": smiles_list
}
)
result_data = client.parse_result(result)
boltz_res = result_data["boltz_res"]
## Display results
for i, item in enumerate(boltz_res, 1):
print(f"{i}. SMILES: {item['smiles']}")
print(f" Affinity Probability: {item['affinity_probability']:.4f}")
print(f" Structure File: {item['cif_file']}\n")
await client.disconnect()
Tool Descriptions
DrugSDA-Model Server:
boltz_binding_affinity: Predict protein-ligand binding affinity using Boltz-2- Args:
protein(list): List of protein chains with sequence information- Each chain:
{'chain': str, 'sequence': str}
- Each chain:
smiles_list(list): List of ligand SMILES strings
- Returns:
boltz_res(list): List of binding predictionssmiles(str): Ligand SMILES stringaffinity_probability(float): Binding affinity probability (0-1)cif_file(str): Path to predicted complex structure
- Args:
Input/Output
Input:
protein: List of protein chainschain: Chain identifier (e.g., 'A', 'B')sequence: Amino acid sequence in single-letter code
smiles_list: List of SMILES strings for ligand molecules
Output:
- List of binding predictions, each containing:
smiles: Ligand SMILES stringaffinity_probability: Binding probability (0-1, higher is better)cif_file: Path to predicted protein-ligand complex structure in CIF format
Affinity Interpretation
- Probability > 0.5: Strong binding likelihood
- Probability 0.3-0.5: Moderate binding potential
- Probability < 0.3: Weak or no binding expected
Use Cases
- Virtual screening of compound libraries
- Lead optimization in drug discovery
- Protein-ligand binding mode prediction
- Structure-based drug design
- Comparative binding analysis across ligands
Performance Notes
- Execution time: 30-120 seconds per ligand depending on protein size
- Protein length: Best for proteins <1000 amino acids
- Multiple ligands: Processes sequentially, allow sufficient time
- Structure output: CIF files can be visualized in PyMOL, ChimeraX, or similar tools
Signals
- GitHub stars
- 167
- Forks
- 9
- Last commit
- Jun 2026
Advanced
- Catalog kind
- skill
- Gateway key
boltz2-binding-affinity- Source
- github.com/internscience/scp