PDB Database
SkillSearchQuery RCSB PDB (200K+ structures) via the public REST + GraphQL APIs with plain `requests` (no SDK). Search by text, attribute, sequence, or 3D structure similarity (Search API); retrieve metadata via GraphQL (Data API); download PDB/mmCIF from files.rcsb.org. For AlphaFold predictions use alphafold-database-access; for protein sequences only use uniprot-protein-database.
Available today. Use it from your connected AI after setup.
No other account needed.
Add ahel to your AI once: Claude, ChatGPT, Cursor, Claude Code or Codex. Then ask it to use this.
Then ask your AI: use the PDB Database skill
What this skill tells your AI
The instructions your AI receives, as published by jaechang-hits/sciagent-skills in skills/structural-biology-drug-discovery/pdb-database/SKILL.md and read by ahel’s review.
Why no SDK? The
rcsb-apiPython SDK is convenient sugar over three public, no-auth REST endpoints (search.rcsb.org,data.rcsb.org,files.rcsb.org). When the SDK is unavailable, every operation can be reproduced with plainrequestsand a small JSON payload. This SKILL.md uses the REST path throughout so the code runs in any environment withrequestsinstalled.
Overview
RCSB PDB is the worldwide repository for 3D structural data of biological macromolecules with 200,000+ experimentally determined structures. Programmatic access is via three free, no-auth endpoints:
| API | Base URL | Method | Purpose |
|---|---|---|---|
| Search | https://search.rcsb.org/rcsbsearch/v2/query | POST JSON | Find PDB IDs by text, attribute filters, sequence, or 3D similarity |
| Data | https://data.rcsb.org/graphql | POST GraphQL | Retrieve structured metadata (entries, polymer entities, assemblies, ligands) |
| Files | https://files.rcsb.org/download/{id}.{format} | GET | Download coordinate files (mmCIF, PDB, FASTA) |
Use this skill for programmatic structural biology queries, drug target analysis, and protein family comparisons.
When to Use
- Searching for protein or nucleic acid crystal/cryo-EM/NMR structures by keyword or property
- Finding structures similar to a query sequence (MMseqs2) or 3D geometry (BioZernike)
- Retrieving experimental metadata (resolution, method, organism, deposition date) for structure sets
- Downloading coordinate files (PDB, mmCIF) for molecular dynamics, docking, or visualization
- Building structure-based datasets for machine learning or drug discovery pipelines
- Comparing protein-ligand complexes across a target family
- For AlphaFold predicted structures, use
alphafold-database-accessinstead - For protein sequence/annotation queries without structures, use
uniprot-protein-databaseinstead
Prerequisites
- Python packages:
requests(only requirement). Optional:biopythonfor parsing downloaded coordinate files. - No API key required: RCSB PDB is freely accessible.
- Rate limits: No published hard limit. Polite delays of
time.sleep(0.2-0.5)between requests are sufficient; implement exponential backoff on HTTP 429.
pip install requests
# Optional, for coordinate parsing:
pip install biopython
Quick Start
Typical search-then-fetch pattern: hit the Search API, get a list of PDB IDs, then resolve metadata via the GraphQL Data API.
import requests
SEARCH = "https://search.rcsb.org/rcsbsearch/v2/query"
DATA = "https://data.rcsb.org/graphql"
# 1. Search: human X-ray structures of "kinase" at resolution < 2.0 Å
payload = {
"query": {
"type": "group", "logical_operator": "and",
"nodes": [
{"type": "terminal", "service": "full_text",
"parameters": {"value": "kinase"}},
{"type": "terminal", "service": "text",
"parameters": {"attribute": "rcsb_entity_source_organism.scientific_name",
"operator": "exact_match", "value": "Homo sapiens"}},
{"type": "terminal", "service": "text",
"parameters": {"attribute": "rcsb_entry_info.resolution_combined",
"operator": "less", "value": 2.0}},
],
},
"return_type": "entry",
"request_options": {"paginate": {"rows": 10}},
}
r = requests.post(SEARCH, json=payload, timeout=30)
r.raise_for_status()
result = r.json()
pdb_ids = [hit["identifier"] for hit in result["result_set"]]
print(f"Total matches: {result['total_count']}, first batch: {pdb_ids}")
# 2. Fetch metadata for the first hit via GraphQL
gql = """{ entry(entry_id: "%s") {
struct { title }
exptl { method }
rcsb_entry_info { resolution_combined deposited_atom_count polymer_entity_count }
} }""" % pdb_ids[0]
r2 = requests.post(DATA, json={"query": gql}, timeout=30)
entry = r2.json()["data"]["entry"]
print(entry["struct"]["title"])
print(f"Method: {entry['exptl'][0]['method']}, Resolution: {entry['rcsb_entry_info']['resolution_combined']} Å")
Core API
Module 1: Text and Attribute Search
Free-text search uses service: "full_text" and searches across all indexed fields.
import requests
SEARCH = "https://search.rcsb.org/rcsbsearch/v2/query"
def text_search(keyword, rows=25):
payload = {
"query": {"type": "terminal", "service": "full_text",
"parameters": {"value": keyword}},
"return_type": "entry",
"request_options": {"paginate": {"rows": rows}},
}
r = requests.post(SEARCH, json=payload, timeout=30)
r.raise_for_status()
data = r.json()
return [hit["identifier"] for hit in data["result_set"]], data["total_count"]
ids, total = text_search("hemoglobin")
print(f"Found {total} structures; first batch: {ids[:5]}")
Attribute search uses service: "text" with structured attribute/operator/value parameters.
import requests
SEARCH = "https://search.rcsb.org/rcsbsearch/v2/query"
def attribute_search(attribute, operator, value, return_type="entry", rows=25):
payload = {
"query": {"type": "terminal", "service": "text",
"parameters": {"attribute": attribute,
"operator": operator,
"value": value}},
"return_type": return_type,
"request_options": {"paginate": {"rows": rows}},
}
r = requests.post(SEARCH, json=payload, timeout=30)
r.raise_for_status()
return r.json()
# Human proteins
human = attribute_search("rcsb_entity_source_organism.scientific_name",
"exact_match", "Homo sapiens", rows=5)
print(f"Human structures: {human['total_count']}")
# X-ray only
xray = attribute_search("exptl.method", "exact_match", "X-RAY DIFFRACTION", rows=5)
print(f"X-ray structures: {xray['total_count']}")
# Resolution range: 1.5–2.5 Å
res = attribute_search(
"rcsb_entry_info.resolution_combined", "range",
{"from": 1.5, "to": 2.5, "include_lower": True, "include_upper": True},
rows=5
)
print(f"1.5–2.5 Å: {res['total_count']}")
Module 2: Sequence Similarity Search
Find structures with similar sequences using MMseqs2. Service is "sequence"; target selects protein vs. nucleic acid.
import requests
SEARCH = "https://search.rcsb.org/rcsbsearch/v2/query"
kras_seq = ("MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQ"
"EEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPS"
"RTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEKMSK")
payload = {
"query": {
"type": "terminal", "service": "sequence",
"parameters": {
"target": "pdb_protein_sequence", # or "pdb_dna_sequence", "pdb_rna_sequence"
"value": kras_seq,
"evalue_cutoff": 0.1,
"identity_cutoff": 0.9,
},
},
"return_type": "polymer_entity",
"request_options": {"paginate": {"rows": 10}},
}
r = requests.post(SEARCH, json=payload, timeout=30)
r.raise_for_status()
data = r.json()
print(f"KRAS-like hits: {data['total_count']}")
for hit in data["result_set"][:5]:
print(f" {hit['identifier']} score={hit.get('score', 'n/a')}")
Module 3: Structure Similarity Search
Find structures with similar 3D geometry using BioZernike descriptors. Service is "structure"; pass the reference entry + assembly ID.
import requests
SEARCH = "https://search.rcsb.org/rcsbsearch/v2/query"
payload = {
"query": {
"type": "terminal", "service": "structure",
"parameters": {
"value": {"entry_id": "4HHB", "assembly_id": "1"},
"operator": "strict_shape_match", # or "relaxed_shape_match"
},
},
"return_type": "polymer_entity",
"request_options": {"paginate": {"rows": 10}},
}
r = requests.post(SEARCH, json=payload, timeout=30)
r.raise_for_status()
data = r.json()
print(f"Structurally similar to 4HHB: {data['total_count']}")
for hit in data["result_set"][:5]:
print(f" {hit['identifier']} score={hit.get('score', 'n/a')}")
Module 4: Data Retrieval (GraphQL)
The GraphQL endpoint at data.rcsb.org/graphql is the canonical way to retrieve structured metadata for known PDB IDs. One request can pull fields across the full data hierarchy (entry → polymer_entity → assembly → chem_comp).
import requests
DATA = "https://data.rcsb.org/graphql"
# Entry-level metadata
gql = """{ entry(entry_id: "4HHB") {
struct { title }
exptl { method }
rcsb_entry_info { resolution_combined deposited_atom_count polymer_entity_count nonpolymer_entity_count }
rcsb_accession_info { deposit_date initial_release_date }
} }"""
r = requests.post(DATA, json={"query": gql}, timeout=30)
entry = r.json()["data"]["entry"]
print(f"Title : {entry['struct']['title']}")
print(f"Method : {entry['exptl'][0]['method']}")
print(f"Resolution : {entry['rcsb_entry_info']['resolution_combined']} Å")
print(f"Atoms : {entry['rcsb_entry_info']['deposited_atom_count']}")
# Polymer entity (sequence, organism, MW)
gql = """{ polymer_entity(entry_id: "4HHB", entity_id: "1") {
entity_poly { pdbx_seq_one_letter_code }
rcsb_polymer_entity { formula_weight }
rcsb_entity_source_organism { scientific_name ncbi_taxonomy_id }
} }"""
r = requests.post(DATA, json={"query": gql}, timeout=30)
pe = r.json()["data"]["polymer_entity"]
print(f"Sequence (first 50): {pe['entity_poly']['pdbx_seq_one_letter_code'][:50]}")
print(f"Organism : {pe['rcsb_entity_source_organism'][0]['scientific_name']}")
print(f"MW : {pe['rcsb_polymer_entity']['formula_weight']}")
# Batch: pull metadata for many entries in one request
gql = """{ entries(entry_ids: ["4HHB", "1A3N", "1HHB"]) {
rcsb_id
struct { title }
exptl { method }
rcsb_entry_info { resolution_combined }
} }"""
r = requests.post(DATA, json={"query": gql}, timeout=30)
for e in r.json()["data"]["entries"]:
res = e["rcsb_entry_info"]["resolution_combined"]
print(f" {e['rcsb_id']}: {e['exptl'][0]['method']:<25} {res} Å — {e['struct']['title'][:40]}")
Module 5: File Download
Coordinate files (mmCIF, PDB, FASTA, assembly variants) are served directly from files.rcsb.org.
import requests
def download_structure(pdb_id, fmt="cif", output_dir="."):
"""Download mmCIF / PDB / FASTA. URLs: .pdb, .cif, /fasta/entry/{ID}, .pdb1 (assembly)."""
url = f"https://files.rcsb.org/download/{pdb_id}.{fmt}"
r = requests.get(url, timeout=60)
if r.status_code == 200:
path = f"{output_dir}/{pdb_id}.{fmt}"
# mmCIF / PDB are text; assemblies and biological units are also text
with open(path, "w") as f:
f.write(r.text)
print(f"Downloaded {path} ({len(r.text)/1024:.1f} KB)")
return path
print(f"HTTP {r.status_code} for {pdb_id}.{fmt}")
return None
download_structure("4HHB", fmt="cif")
download_structure("4HHB", fmt="pdb")
# FASTA sequence for an entry
r = requests.get("https://www.rcsb.org/fasta/entry/4HHB", timeout=30)
r.raise_for_status()
print(r.text[:400])
Module 6: Query Composition (group + logical_operator)
Combine terminal queries with type: "group" and a logical_operator of "and" / "or". Nested groups give arbitrary boolean expressions; negation is via "node_id" references with "operator": "negate" on the group (rare — usually expressed as the inverse attribute filter).
import requests, datetime
SEARCH = "https://search.rcsb.org/rcsbsearch/v2/query"
# AND: high-resolution human structures
q_and = {
"type": "group", "logical_operator": "and",
"nodes": [
{"type": "terminal", "service": "text",
"parameters": {"attribute": "rcsb_entity_source_organism.scientific_name",
"operator": "exact_match", "value": "Homo sapiens"}},
{"type": "terminal", "service": "text",
"parameters": {"attribute": "rcsb_entry_info.resolution_combined",
"operator": "less", "value": 2.0}},
],
}
# OR: human or mouse
q_or = {
"type": "group", "logical_operator": "or",
"nodes": [
{"type": "terminal", "service": "text",
"parameters": {"attribute": "rcsb_entity_source_organism.scientific_name",
"operator": "exact_match", "value": "Homo sapiens"}},
{"type": "terminal", "service": "text",
"parameters": {"attribute": "rcsb_entity_source_organism.scientific_name",
"operator": "exact_match", "value": "Mus musculus"}},
],
}
# Combined: recent (last 30 days) + high-quality
one_month_ago = (datetime.date.today() - datetime.timedelta(days=30)).isoformat()
today = datetime.date.today().isoformat()
q_recent_hq = {
"type": "group", "logical_operator": "and",
"nodes": [
{"type": "terminal", "service": "text",
"parameters": {"attribute": "rcsb_entry_info.resolution_combined",
"operator": "less", "value": 2.0}},
{"type": "terminal", "service": "text",
"parameters": {"attribute": "refine.ls_R_factor_R_free",
"operator": "less", "value": 0.25}},
{"type": "terminal", "service": "text",
"parameters": {"attribute": "rcsb_accession_info.initial_release_date",
"operator": "range",
"value": {"from": one_month_ago, "to": today,
"include_lower": True, "include_upper": True}}},
],
}
payload = {"query": q_recent_hq, "return_type": "entry",
"request_options": {"paginate": {"rows": 5}}}
r = requests.post(SEARCH, json=payload, timeout=30)
print(f"Recent high-quality: {r.json()['total_count']} structures")
Module 7: Pagination + Batch with Rate Limiting
Search responses include total_count. Paginate with request_options.paginate.start and rows (max ~10000 per page in practice; 100–500 is a good batch size).
import requests, time
SEARCH = "https://search.rcsb.org/rcsbsearch/v2/query"
def search_all(query_node, return_type="entry", page=100, max_results=None, delay=0.3):
"""Paginate through every result; rate-limit between pages."""
out, start = [], 0
while True:
payload = {"query": query_node, "return_type": return_type,
"request_options": {"paginate": {"start": start, "rows": page}}}
r = requests.post(SEARCH, json=payload, timeout=30)
r.raise_for_status()
d = r.json()
batch = [h["identifier"] for h in d.get("result_set", [])]
if not batch:
break
out.extend(batch)
if max_results and len(out) >= max_results:
return out[:max_results]
if len(batch) < page or len(out) >= d.get("total_count", 0):
break
start += page
time.sleep(delay)
return out
# Example: every insulin entry
ids = search_all(
{"type": "terminal", "service": "full_text", "parameters": {"value": "insulin"}},
max_results=300,
)
print(f"Insulin entries collected: {len(ids)}")
# Batch metadata fetch via GraphQL `entries(...)` to avoid one round-trip per ID
DATA = "https://data.rcsb.org/graphql"
def batch_metadata(pdb_ids, chunk=50):
"""Fetch (title, method, resolution) for many entries with one POST per chunk."""
all_rows = []
for i in range(0, len(pdb_ids), chunk):
ids_arr = pdb_ids[i:i+chunk]
ids_str = ", ".join(f'"{p}"' for p in ids_arr)
gql = f"""{{ entries(entry_ids: [{ids_str}]) {{
rcsb_id
struct {{ title }}
exptl {{ method }}
rcsb_entry_info {{ resolution_combined }}
}} }}"""
r = requests.post(DATA, json={"query": gql}, timeout=60)
r.raise_for_status()
for e in r.json()["data"]["entries"]:
res = e["rcsb_entry_info"]["resolution_combined"]
all_rows.append({
"pdb_id": e["rcsb_id"],
"method": e["exptl"][0]["method"] if e["exptl"] else None,
"resolution": res[0] if isinstance(res, list) and res else res,
"title": e["struct"]["title"],
})
return all_rows
rows = batch_metadata(ids[:20])
for r in rows[:5]:
print(f" {r['pdb_id']}: {r['method']:<25} {r['resolution']} Å — {r['title'][:50]}")
Key Concepts
Search Service Cheat Sheet
| Service | Use case | Required parameters |
|---|---|---|
full_text | Free-text keyword across all indexed fields | value (string) |
text | Structured attribute filter | attribute, operator, value |
sequence | MMseqs2 sequence similarity | target ∈ {pdb_protein_sequence, pdb_dna_sequence, pdb_rna_sequence}, value (sequence), evalue_cutoff, identity_cutoff |
seqmotif | Pattern / regex / PROSITE motif | value (pattern), pattern_type ∈ {simple, prosite, regex} |
structure | 3D shape similarity (BioZernike) | value ({entry_id, assembly_id}), operator ∈ {strict_shape_match, relaxed_shape_match} |
strucmotif | 3D residue-arrangement motif | value (residue list), rmsd_cutoff |
chemical | Ligand similarity by SMILES/InChI | value, match_type ∈ {graph-exact, graph-relaxed, fingerprint-similarity, sub-structure-stereo-relaxed} |
AttributeQuery Operators (service: "text")
| Operator | Value shape | Example |
|---|---|---|
exact_match | string | "Homo sapiens" |
contains_words / contains_phrase | string | "tyrosine kinase" |
equals / greater / less / greater_or_equal / less_or_equal | number | 2.0 |
range | {from, to, include_lower, include_upper} | {"from": 1.5, "to": 2.5, "include_lower": True, "include_upper": True} |
exists | (none) | — |
in | array | ["X-RAY DIFFRACTION", "ELECTRON MICROSCOPY"] |
Return Types
return_type controls the granularity of identifiers in result_set:
return_type | Identifier shape | Example |
|---|---|---|
entry | 4HHB | One per PDB ID |
polymer_entity | 4HHB_1 | One per polymer chain entity |
non_polymer_entity | 4HHB_2 | Ligands, cofactors |
assembly | 4HHB-1 | Biological unit |
polymer_instance | 4HHB.A | Individual chain coordinates |
mol_definition | HEM | Chemical component (PDB ligand code) |
Common Data API GraphQL Roots
| Root | Identifier shape | Returns |
|---|---|---|
entry(entry_id: ...) | "4HHB" | Entry-level metadata |
entries(entry_ids: [...]) | array | Batch entry lookup |
polymer_entity(entry_id: ..., entity_id: ...) | "4HHB", "1" | Sequence + organism |
polymer_entity_instance(entry_id: ..., asym_id: ...) | "4HHB", "A" | Chain-level coords/metadata |
assembly(entry_id: ..., assembly_id: ...) | "4HHB", "1" | Biological assembly |
chem_comp(comp_id: ...) | "HEM" | Small molecule reference |
File Formats
| Format | URL pattern | Notes |
|---|---|---|
| mmCIF | https://files.rcsb.org/download/{id}.cif | Recommended; no atom-count limit |
| PDB | https://files.rcsb.org/download/{id}.pdb | Legacy; 99,999 atom limit |
| Assembly (mmCIF) | https://files.rcsb.org/download/{id}-assembly{N}.cif | Biological unit |
| FASTA | https://www.rcsb.org/fasta/entry/{id} | Sequence only |
Common Workflows
Workflow 1: Drug Target Structure Set
Goal: Find high-resolution human EGFR structures with bound ligands.
import requests, time
SEARCH = "https://search.rcsb.org/rcsbsearch/v2/query"
DATA = "https://data.rcsb.org/graphql"
payload = {
"query": {
"type": "group", "logical_operator": "and",
"nodes": [
{"type": "terminal", "service": "full_text",
"parameters": {"value": "EGFR epidermal growth factor receptor"}},
{"type": "terminal", "service": "text",
"parameters": {"attribute": "rcsb_entity_source_organism.scientific_name",
"operator": "exact_match", "value": "Homo sapiens"}},
{"type": "terminal", "service": "text",
"parameters": {"attribute": "rcsb_entry_info.resolution_combined",
"operator": "less", "value": 2.5}},
],
},
"return_type": "entry",
"request_options": {"paginate": {"rows": 50}},
}
r = requests.post(SEARCH, json=payload, timeout=30)
r.raise_for_status()
pdb_ids = [h["identifier"] for h in r.json()["result_set"]]
print(f"EGFR ≤2.5 Å human structures: {len(pdb_ids)}")
# Filter to entries with bound ligands via batch GraphQL
ids_str = ", ".join(f'"{p}"' for p in pdb_ids[:20])
gql = f"""{{ entries(entry_ids: [{ids_str}]) {{
rcsb_id
struct {{ title }}
rcsb_entry_info {{ resolution_combined nonpolymer_entity_count }}
}} }}"""
r2 = requests.post(DATA, json={"query": gql}, timeout=60)
for e in r2.json()["data"]["entries"]:
n_lig = e["rcsb_entry_info"]["nonpolymer_entity_count"] or 0
if n_lig > 0:
res = e["rcsb_entry_info"]["resolution_combined"]
res_v = res[0] if isinstance(res, list) else res
print(f" {e['rcsb_id']}: {res_v} Å, ligands={n_lig} — {e['struct']['title'][:60]}")
time.sleep(0.05)
Workflow 2: Protein Family — Sequence-Similar Structures
Goal: Find all PDB structures with sequence similar to a query (KRAS), then summarize their resolution + experimental method.
import requests, time
SEARCH = "https://search.rcsb.org/rcsbsearch/v2/query"
DATA = "https://data.rcsb.org/graphql"
kras_seq = ("MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQ"
"EEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPS"
"RTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEKMSK")
payload = {
"query": {
"type": "terminal", "service": "sequence",
"parameters": {"target": "pdb_protein_sequence", "value": kras_seq,
"evalue_cutoff": 1e-5, "identity_cutoff": 0.5},
},
"return_type": "polymer_entity",
"request_options": {"paginate": {"rows": 20}},
}
r = requests.post(SEARCH, json=payload, timeout=30)
hits = r.json()["result_set"]
print(f"KRAS family hits: {len(hits)}")
# Unique PDB IDs from polymer_entity identifiers (e.g., "4OBE_1" -> "4OBE")
entry_ids = sorted({h["identifier"].split("_")[0] for h in hits})
# Batch metadata
ids_str = ", ".join(f'"{p}"' for p in entry_ids)
gql = f"""{{ entries(entry_ids: [{ids_str}]) {{
rcsb_id
struct {{ title }}
exptl {{ method }}
rcsb_entry_info {{ resolution_combined }}
}} }}"""
r2 = requests.post(DATA, json={"query": gql}, timeout=60)
for e in sorted(r2.json()["data"]["entries"],
key=lambda x: (x["rcsb_entry_info"]["resolution_combined"] or [99])[0] if isinstance(x["rcsb_entry_info"]["resolution_combined"], list) else (x["rcsb_entry_info"]["resolution_combined"] or 99)):
res = e["rcsb_entry_info"]["resolution_combined"]
res_v = res[0] if isinstance(res, list) else res
print(f" {e['rcsb_id']}: {res_v} Å {e['exptl'][0]['method']:<25} {e['struct']['title'][:50]}")
Workflow 3: Download + Parse with BioPython
Goal: Download mmCIF, then enumerate chains with BioPython.
import requests
from Bio.PDB import MMCIFParser
pdb_id = "4HHB"
r = requests.get(f"https://files.rcsb.org/download/{pdb_id}.cif", timeout=60)
r.raise_for_status()
with open(f"{pdb_id}.cif", "w") as f:
f.write(r.text)
parser = MMCIFParser(QUIET=True)
structure = parser.get_structure(pdb_id, f"{pdb_id}.cif")
for model in structure:
for chain in model:
std_res = [r for r in chain if r.id[0] == " "]
atoms = sum(len(list(r.get_atoms())) for r in std_res)
print(f"Chain {chain.id}: {len(std_res)} residues, {atoms} atoms")
Key Parameters
Shortened here. Read the whole file on GitHub.
Signals
- GitHub stars
- 367
- Forks
- 36
- Last commit
- Aug 2026
ahel review
K1binfo
installs-packages
Automated review, not a security audit. Ruleset v1+k2.
Advanced
- Item type
- skill
- Key
pdb-database-jaechang-hits- Source
- github.com/jaechang-hits/sciagent-skills